Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S004

Protein Details
Accession A0A2Z6S004    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ASTCKEGCKIHWKRRQQNSCKQCGKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRAEFICQYISNEGNVCGRASTCKEGCKIHWKRRQQNSCKQCGKPTTSIHGMCNLHVDKYYSKTYYHRKKLNALEKSALEKSALGNFQLSEAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.13
5 0.13
6 0.16
7 0.19
8 0.24
9 0.25
10 0.28
11 0.31
12 0.33
13 0.37
14 0.44
15 0.49
16 0.52
17 0.59
18 0.65
19 0.72
20 0.81
21 0.87
22 0.85
23 0.86
24 0.84
25 0.86
26 0.83
27 0.74
28 0.69
29 0.64
30 0.6
31 0.56
32 0.5
33 0.45
34 0.43
35 0.43
36 0.37
37 0.38
38 0.33
39 0.27
40 0.29
41 0.24
42 0.19
43 0.18
44 0.2
45 0.15
46 0.18
47 0.22
48 0.18
49 0.2
50 0.27
51 0.37
52 0.46
53 0.54
54 0.56
55 0.57
56 0.64
57 0.72
58 0.75
59 0.71
60 0.65
61 0.6
62 0.55
63 0.57
64 0.49
65 0.4
66 0.3
67 0.25
68 0.22
69 0.24
70 0.23
71 0.18
72 0.18
73 0.17
74 0.17
75 0.17