Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6Q2X0

Protein Details
Accession A0A2Z6Q2X0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-95KPGSSRFMKRNPPSKNKNKKTNNSSLDKAHydrophilic
NLS Segment(s)
PositionSequence
63-86KSSSKPGSSRFMKRNPPSKNKNKK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MLGYFENYEDLKVALESLFVYERTEFKWYRSSSHLPKKNSVQNLARSSQKCSKKNSGAQGSPKSSSKPGSSRFMKRNPPSKNKNKKTNNSSLDKADILKLVLSLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.09
6 0.09
7 0.1
8 0.11
9 0.12
10 0.14
11 0.19
12 0.18
13 0.19
14 0.28
15 0.27
16 0.3
17 0.35
18 0.41
19 0.46
20 0.56
21 0.61
22 0.56
23 0.61
24 0.65
25 0.65
26 0.61
27 0.58
28 0.53
29 0.53
30 0.54
31 0.5
32 0.49
33 0.43
34 0.45
35 0.46
36 0.5
37 0.46
38 0.49
39 0.54
40 0.55
41 0.59
42 0.62
43 0.6
44 0.56
45 0.59
46 0.58
47 0.53
48 0.48
49 0.44
50 0.37
51 0.33
52 0.31
53 0.29
54 0.3
55 0.31
56 0.38
57 0.43
58 0.49
59 0.55
60 0.6
61 0.65
62 0.67
63 0.72
64 0.73
65 0.76
66 0.79
67 0.82
68 0.86
69 0.85
70 0.88
71 0.9
72 0.9
73 0.89
74 0.9
75 0.87
76 0.82
77 0.77
78 0.7
79 0.63
80 0.54
81 0.46
82 0.37
83 0.3
84 0.24
85 0.2
86 0.16