Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R5H2

Protein Details
Accession A0A2Z6R5H2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-102QSALTRNQKKKLRKKNKKLQHKQLPISQHydrophilic
NLS Segment(s)
PositionSequence
82-95QKKKLRKKNKKLQH
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, golg 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MAFLKSPKVLFFKLEYLDFVPIRCKFRFLKISVLELKKSLELFDSLNEMDVPVYGSTDYEYSSDEGSKIQEDTFQSALTRNQKKKLRKKNKKLQHKQLPISQHPKAEPVQYKPLAQQANILNTLISLIVHTALRVYSGILNSQDSLAEIFSLLEKKVGDTVDYKISHADQNPVNSGISH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.27
4 0.31
5 0.28
6 0.25
7 0.27
8 0.28
9 0.33
10 0.3
11 0.33
12 0.31
13 0.4
14 0.48
15 0.43
16 0.48
17 0.46
18 0.53
19 0.56
20 0.57
21 0.49
22 0.41
23 0.4
24 0.32
25 0.3
26 0.23
27 0.16
28 0.14
29 0.13
30 0.13
31 0.15
32 0.12
33 0.13
34 0.12
35 0.11
36 0.09
37 0.08
38 0.09
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.09
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.1
58 0.11
59 0.14
60 0.14
61 0.13
62 0.13
63 0.14
64 0.18
65 0.24
66 0.32
67 0.32
68 0.4
69 0.47
70 0.57
71 0.66
72 0.73
73 0.76
74 0.79
75 0.87
76 0.89
77 0.92
78 0.93
79 0.93
80 0.93
81 0.92
82 0.89
83 0.82
84 0.77
85 0.74
86 0.69
87 0.65
88 0.57
89 0.48
90 0.4
91 0.39
92 0.35
93 0.35
94 0.32
95 0.3
96 0.36
97 0.34
98 0.35
99 0.33
100 0.38
101 0.33
102 0.29
103 0.3
104 0.25
105 0.27
106 0.26
107 0.25
108 0.18
109 0.16
110 0.17
111 0.11
112 0.08
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.07
123 0.08
124 0.09
125 0.11
126 0.12
127 0.13
128 0.13
129 0.13
130 0.12
131 0.1
132 0.1
133 0.08
134 0.07
135 0.06
136 0.06
137 0.07
138 0.09
139 0.09
140 0.1
141 0.1
142 0.11
143 0.14
144 0.14
145 0.14
146 0.15
147 0.18
148 0.24
149 0.25
150 0.25
151 0.24
152 0.26
153 0.29
154 0.29
155 0.32
156 0.28
157 0.32
158 0.35
159 0.34