Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CEY1

Protein Details
Accession A1CEY1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
133-156QKGGRGGRARSRSRDRSRSPGADNBasic
NLS Segment(s)
PositionSequence
124-151PSNKGKNGAQKGGRGGRARSRSRDRSRS
Subcellular Location(s) cyto_nucl 16, nucl 14, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR008111  RNA-bd_8  
IPR000504  RRM_dom  
IPR033744  RRM_RBM8  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0006396  P:RNA processing  
KEGG act:ACLA_091280  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12324  RRM_RBM8  
Amino Acid Sequences MSAEMEVDPPVSQEQEEVPQTQSGNDPRTQAGAVAVRSIEGWIIIATNIHEEASEEDVTDLFAEYGEIKNFSLNLDRRTGYVKGYALIEYSTLPEASDAIKALNGTKLLDQTIQVDYAFVRPPPSNKGKNGAQKGGRGGRARSRSRDRSRSPGADNERD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.17
3 0.19
4 0.19
5 0.2
6 0.21
7 0.21
8 0.21
9 0.25
10 0.25
11 0.27
12 0.27
13 0.28
14 0.26
15 0.28
16 0.27
17 0.22
18 0.19
19 0.19
20 0.17
21 0.16
22 0.15
23 0.13
24 0.13
25 0.13
26 0.09
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.08
40 0.11
41 0.1
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.07
48 0.04
49 0.04
50 0.04
51 0.04
52 0.06
53 0.06
54 0.07
55 0.06
56 0.07
57 0.07
58 0.07
59 0.13
60 0.15
61 0.16
62 0.18
63 0.19
64 0.19
65 0.22
66 0.22
67 0.17
68 0.17
69 0.15
70 0.14
71 0.14
72 0.13
73 0.1
74 0.1
75 0.09
76 0.06
77 0.07
78 0.07
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.07
85 0.06
86 0.05
87 0.06
88 0.06
89 0.07
90 0.09
91 0.08
92 0.09
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.12
99 0.12
100 0.12
101 0.11
102 0.1
103 0.09
104 0.11
105 0.12
106 0.1
107 0.13
108 0.14
109 0.17
110 0.25
111 0.33
112 0.37
113 0.39
114 0.46
115 0.51
116 0.59
117 0.63
118 0.64
119 0.59
120 0.57
121 0.61
122 0.61
123 0.59
124 0.53
125 0.51
126 0.52
127 0.57
128 0.6
129 0.62
130 0.66
131 0.7
132 0.76
133 0.82
134 0.8
135 0.8
136 0.82
137 0.8
138 0.75
139 0.74