Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S2E3

Protein Details
Accession A0A2Z6S2E3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
67-101LYLKQHGKKRPVEKMQQRNIRYKRPKNASNMRQNIHydrophilic
NLS Segment(s)
PositionSequence
75-76KR
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MKQFRLIKQWELEDRIAAAANYHPQVLEVLTNPNISTRNVCVNCNITKSPAWRRDDHGKLLCNACGLYLKQHGKKRPVEKMQQRNIRYKRPKNASNMRQNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.26
4 0.19
5 0.14
6 0.11
7 0.14
8 0.13
9 0.13
10 0.12
11 0.11
12 0.12
13 0.12
14 0.11
15 0.08
16 0.11
17 0.12
18 0.13
19 0.12
20 0.13
21 0.14
22 0.14
23 0.15
24 0.13
25 0.21
26 0.22
27 0.23
28 0.24
29 0.26
30 0.27
31 0.29
32 0.27
33 0.2
34 0.21
35 0.26
36 0.32
37 0.35
38 0.37
39 0.36
40 0.41
41 0.48
42 0.5
43 0.52
44 0.48
45 0.43
46 0.42
47 0.41
48 0.36
49 0.27
50 0.23
51 0.16
52 0.14
53 0.13
54 0.13
55 0.2
56 0.26
57 0.33
58 0.4
59 0.47
60 0.52
61 0.6
62 0.66
63 0.68
64 0.7
65 0.74
66 0.78
67 0.82
68 0.84
69 0.85
70 0.81
71 0.81
72 0.8
73 0.8
74 0.81
75 0.8
76 0.8
77 0.81
78 0.83
79 0.83
80 0.87
81 0.86