Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RD75

Protein Details
Accession A0A2Z6RD75    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
69-90FGSIKKSKSKDSFKKTKNSSSSHydrophilic
NLS Segment(s)
PositionSequence
73-84KKSKSKDSFKKT
Subcellular Location(s) nucl 12, mito 9, cyto_mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MFGYLPIKAIKHFETGGKASIVVFFKKYEDVEICRRTRFNFNHNDVDYSLLWCLALLTTSQTKKSKDSFGSIKKSKSKDSFKKTKNSSSSKTHLTNFKPSKKHMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.25
5 0.23
6 0.2
7 0.23
8 0.22
9 0.18
10 0.17
11 0.16
12 0.16
13 0.18
14 0.19
15 0.18
16 0.19
17 0.22
18 0.29
19 0.36
20 0.37
21 0.37
22 0.38
23 0.37
24 0.43
25 0.43
26 0.42
27 0.44
28 0.48
29 0.53
30 0.52
31 0.51
32 0.42
33 0.41
34 0.33
35 0.24
36 0.18
37 0.11
38 0.1
39 0.07
40 0.07
41 0.04
42 0.04
43 0.03
44 0.05
45 0.09
46 0.11
47 0.16
48 0.19
49 0.21
50 0.25
51 0.28
52 0.33
53 0.31
54 0.37
55 0.41
56 0.46
57 0.54
58 0.54
59 0.58
60 0.58
61 0.6
62 0.62
63 0.62
64 0.65
65 0.66
66 0.72
67 0.76
68 0.75
69 0.82
70 0.8
71 0.81
72 0.79
73 0.77
74 0.74
75 0.71
76 0.7
77 0.68
78 0.66
79 0.62
80 0.61
81 0.58
82 0.63
83 0.64
84 0.67
85 0.66