Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SAK1

Protein Details
Accession A0A2Z6SAK1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-77PPPPQRTWTKVQSKKKGKRNRRKTKTSNQYLHHNLHydrophilic
NLS Segment(s)
PositionSequence
55-67SKKKGKRNRRKTK
Subcellular Location(s) nucl 16, cyto_nucl 13.833, cyto 7.5, cyto_pero 4.832
Family & Domain DBs
Amino Acid Sequences MELSQNKYFMEEQLLPTDNDSSSETEESSSIISYSVYREGDEPPPPQRTWTKVQSKKKGKRNRRKTKTSNQYLHHNLLPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.25
4 0.25
5 0.19
6 0.18
7 0.17
8 0.14
9 0.14
10 0.15
11 0.14
12 0.13
13 0.13
14 0.11
15 0.1
16 0.09
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.09
23 0.09
24 0.09
25 0.1
26 0.13
27 0.15
28 0.18
29 0.19
30 0.2
31 0.24
32 0.23
33 0.26
34 0.27
35 0.29
36 0.32
37 0.4
38 0.47
39 0.52
40 0.63
41 0.7
42 0.78
43 0.83
44 0.87
45 0.88
46 0.89
47 0.91
48 0.92
49 0.93
50 0.92
51 0.94
52 0.94
53 0.94
54 0.94
55 0.93
56 0.91
57 0.84
58 0.84
59 0.79
60 0.74
61 0.65