Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RWR2

Protein Details
Accession A0A2Z6RWR2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-59EILDAKKKRKKTATNKKAKKLGFBasic
NLS Segment(s)
PositionSequence
40-57DAKKKRKKTATNKKAKKL
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MTDKGRYRIHGDCIICGAHKNTLTCENWEVKTHSKREILDAKKKRKKTATNKKAKKLGFKILDANENVQTYIKRYLREATKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.26
4 0.21
5 0.18
6 0.2
7 0.2
8 0.2
9 0.26
10 0.27
11 0.28
12 0.29
13 0.29
14 0.28
15 0.3
16 0.3
17 0.32
18 0.37
19 0.37
20 0.38
21 0.38
22 0.37
23 0.4
24 0.46
25 0.45
26 0.49
27 0.56
28 0.61
29 0.65
30 0.69
31 0.69
32 0.69
33 0.73
34 0.74
35 0.76
36 0.76
37 0.8
38 0.86
39 0.87
40 0.86
41 0.79
42 0.78
43 0.72
44 0.71
45 0.64
46 0.58
47 0.57
48 0.51
49 0.53
50 0.44
51 0.41
52 0.34
53 0.29
54 0.27
55 0.22
56 0.2
57 0.18
58 0.26
59 0.27
60 0.25
61 0.27
62 0.35
63 0.42