Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SND3

Protein Details
Accession A0A2Z6SND3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
228-247TDESRERCGRENKRQEKEAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002500  PAPS_reduct  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01507  PAPS_reduct  
CDD cd01713  PAPS_reductase  
Amino Acid Sequences MASSADEARVYFSKIHKEVYELANSEQPISKRITFALKVIEESLERYGLDGVSLSFNGGKDCVVLLHLFAAVYYKFYQNSDEIPNIQALYVTHPNPFSEVDEFVEECEQRYCLNIVKIEGSMKPTLTIYLKQNPNIKAILVGTRRNDPHGGKLKEFTPTDHGWPSIMRVHPILDMHYTQIWEFLRILNVPYCILYDLGYTSLGSKNNTFPNPDLKRPNGDYYPAWKLTDESRERCGRENKRQEKEAAAIKDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.34
4 0.36
5 0.4
6 0.4
7 0.41
8 0.34
9 0.34
10 0.34
11 0.33
12 0.31
13 0.3
14 0.26
15 0.23
16 0.26
17 0.26
18 0.23
19 0.25
20 0.3
21 0.28
22 0.29
23 0.34
24 0.29
25 0.29
26 0.28
27 0.28
28 0.21
29 0.21
30 0.21
31 0.14
32 0.13
33 0.12
34 0.12
35 0.1
36 0.1
37 0.08
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.06
56 0.06
57 0.07
58 0.06
59 0.08
60 0.1
61 0.11
62 0.11
63 0.12
64 0.15
65 0.14
66 0.17
67 0.19
68 0.19
69 0.19
70 0.18
71 0.19
72 0.16
73 0.15
74 0.12
75 0.09
76 0.13
77 0.16
78 0.16
79 0.17
80 0.17
81 0.17
82 0.18
83 0.19
84 0.15
85 0.13
86 0.13
87 0.13
88 0.13
89 0.13
90 0.12
91 0.13
92 0.11
93 0.1
94 0.1
95 0.09
96 0.07
97 0.09
98 0.09
99 0.1
100 0.12
101 0.13
102 0.13
103 0.13
104 0.14
105 0.14
106 0.14
107 0.14
108 0.12
109 0.11
110 0.11
111 0.1
112 0.11
113 0.11
114 0.14
115 0.15
116 0.22
117 0.25
118 0.28
119 0.34
120 0.34
121 0.35
122 0.32
123 0.28
124 0.21
125 0.19
126 0.22
127 0.19
128 0.21
129 0.2
130 0.24
131 0.25
132 0.26
133 0.29
134 0.24
135 0.3
136 0.37
137 0.38
138 0.34
139 0.36
140 0.35
141 0.37
142 0.37
143 0.29
144 0.25
145 0.24
146 0.26
147 0.26
148 0.25
149 0.19
150 0.19
151 0.2
152 0.2
153 0.19
154 0.17
155 0.16
156 0.17
157 0.17
158 0.18
159 0.17
160 0.14
161 0.14
162 0.14
163 0.15
164 0.14
165 0.12
166 0.16
167 0.15
168 0.14
169 0.14
170 0.13
171 0.14
172 0.14
173 0.16
174 0.14
175 0.14
176 0.13
177 0.13
178 0.13
179 0.11
180 0.11
181 0.1
182 0.08
183 0.08
184 0.09
185 0.09
186 0.08
187 0.09
188 0.12
189 0.14
190 0.15
191 0.17
192 0.21
193 0.28
194 0.3
195 0.32
196 0.31
197 0.4
198 0.44
199 0.5
200 0.52
201 0.49
202 0.54
203 0.55
204 0.6
205 0.52
206 0.5
207 0.46
208 0.45
209 0.49
210 0.44
211 0.4
212 0.34
213 0.33
214 0.34
215 0.41
216 0.42
217 0.38
218 0.43
219 0.49
220 0.51
221 0.57
222 0.62
223 0.62
224 0.66
225 0.73
226 0.76
227 0.78
228 0.82
229 0.77
230 0.72
231 0.69
232 0.66