Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R3S6

Protein Details
Accession A0A2Z6R3S6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-63EQKGRSQGRKEKKTRVKEKNLTLBasic
NLS Segment(s)
PositionSequence
46-57SQGRKEKKTRVK
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, mito 5
Family & Domain DBs
Amino Acid Sequences MFVEKVFLCSHYGNIPGKICGLSLTVVNHMLELNQVLEVEEQKGRSQGRKEKKTRVKEKNLTLATCVRGSTVLSTEHGKYYDINTRFRVFDNENRKLCSVASLIVWRTTTKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.25
4 0.25
5 0.24
6 0.21
7 0.16
8 0.14
9 0.11
10 0.11
11 0.12
12 0.12
13 0.13
14 0.13
15 0.12
16 0.11
17 0.1
18 0.09
19 0.08
20 0.07
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.08
27 0.09
28 0.09
29 0.1
30 0.14
31 0.14
32 0.19
33 0.25
34 0.32
35 0.42
36 0.51
37 0.57
38 0.64
39 0.72
40 0.78
41 0.82
42 0.83
43 0.83
44 0.8
45 0.8
46 0.78
47 0.71
48 0.61
49 0.53
50 0.46
51 0.37
52 0.3
53 0.24
54 0.15
55 0.13
56 0.13
57 0.11
58 0.1
59 0.09
60 0.1
61 0.13
62 0.13
63 0.15
64 0.15
65 0.14
66 0.13
67 0.16
68 0.24
69 0.24
70 0.27
71 0.29
72 0.31
73 0.32
74 0.33
75 0.35
76 0.32
77 0.38
78 0.44
79 0.5
80 0.5
81 0.53
82 0.52
83 0.46
84 0.41
85 0.36
86 0.28
87 0.2
88 0.2
89 0.22
90 0.23
91 0.24
92 0.25