Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QHT0

Protein Details
Accession A0A2Z6QHT0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-72NKTIAKKPMRRSVRIKNMNAKHydrophilic
NLS Segment(s)
PositionSequence
27-71NRAKAKRETQRGRTTDKKPAERTTANKTIAKKPMRRSVRIKNMNA
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MGLNAIAQELALRMLESHYNSPVTRGNRAKAKRETQRGRTTDKKPAERTTANKTIAKKPMRRSVRIKNMNAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.13
4 0.15
5 0.16
6 0.18
7 0.18
8 0.2
9 0.25
10 0.24
11 0.3
12 0.32
13 0.35
14 0.41
15 0.45
16 0.51
17 0.53
18 0.59
19 0.6
20 0.67
21 0.69
22 0.69
23 0.74
24 0.69
25 0.68
26 0.68
27 0.64
28 0.63
29 0.63
30 0.62
31 0.58
32 0.6
33 0.6
34 0.57
35 0.58
36 0.57
37 0.57
38 0.54
39 0.52
40 0.52
41 0.53
42 0.56
43 0.6
44 0.59
45 0.59
46 0.65
47 0.69
48 0.73
49 0.74
50 0.76
51 0.79
52 0.81