Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RHQ0

Protein Details
Accession A0A2Z6RHQ0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-72SYTSLVIRIRRNRRRLRRRTRINDTLNRISHydrophilic
NLS Segment(s)
PositionSequence
51-62IRRNRRRLRRRT
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MDQSRNPNFTENDGEISNISNNNLNISGDSSDASSYKTNNSSSYTSLVIRIRRNRRRLRRRTRINDTLNRISILPIQNTNDPFQNQIFNGSAFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.22
4 0.2
5 0.15
6 0.14
7 0.14
8 0.14
9 0.15
10 0.15
11 0.14
12 0.12
13 0.13
14 0.13
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.1
21 0.09
22 0.1
23 0.12
24 0.14
25 0.15
26 0.16
27 0.19
28 0.19
29 0.19
30 0.21
31 0.19
32 0.17
33 0.19
34 0.21
35 0.22
36 0.26
37 0.33
38 0.42
39 0.49
40 0.59
41 0.66
42 0.74
43 0.81
44 0.86
45 0.89
46 0.89
47 0.92
48 0.93
49 0.92
50 0.91
51 0.89
52 0.86
53 0.83
54 0.78
55 0.68
56 0.59
57 0.49
58 0.41
59 0.37
60 0.32
61 0.26
62 0.23
63 0.25
64 0.29
65 0.31
66 0.32
67 0.31
68 0.28
69 0.28
70 0.27
71 0.28
72 0.24
73 0.26
74 0.25