Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QNS9

Protein Details
Accession A0A2Z6QNS9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-79LPPQRTWTKVQSKKKGKKKQKKNKNKQSVSPPRPTIHydrophilic
NLS Segment(s)
PositionSequence
55-70SKKKGKKKQKKNKNKQ
Subcellular Location(s) nucl 19.5, cyto_nucl 14.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
Amino Acid Sequences MELSQNKYFMEEEYLPTDNDSSSEAEEPSSTISYSVYREGDEPLPPQRTWTKVQSKKKGKKKQKKNKNKQSVSPPRPTIPPIETTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.24
4 0.23
5 0.16
6 0.15
7 0.14
8 0.1
9 0.11
10 0.12
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.1
17 0.08
18 0.07
19 0.08
20 0.09
21 0.1
22 0.12
23 0.11
24 0.11
25 0.11
26 0.13
27 0.14
28 0.14
29 0.14
30 0.16
31 0.19
32 0.19
33 0.21
34 0.21
35 0.24
36 0.27
37 0.34
38 0.4
39 0.46
40 0.57
41 0.65
42 0.73
43 0.8
44 0.87
45 0.89
46 0.89
47 0.91
48 0.92
49 0.93
50 0.93
51 0.95
52 0.96
53 0.96
54 0.96
55 0.93
56 0.9
57 0.91
58 0.91
59 0.87
60 0.85
61 0.79
62 0.71
63 0.67
64 0.61
65 0.56
66 0.48
67 0.45