Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RT26

Protein Details
Accession A0A2Z6RT26    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-111MPTLPKDINKPKNKKYKFSVNPSNEKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
Amino Acid Sequences MVVRIRLARHGIKIRNRPFYNIVVANAKAPRDGKHIEKVGLYDPIPNEHGIKNIELNTDRIKYWLSVGAWPSDTVARLLSKAGIMPTLPKDINKPKNKKYKFSVNPSNEKLEDKPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.71
4 0.68
5 0.64
6 0.59
7 0.56
8 0.48
9 0.42
10 0.36
11 0.35
12 0.33
13 0.31
14 0.27
15 0.23
16 0.22
17 0.21
18 0.23
19 0.26
20 0.27
21 0.32
22 0.35
23 0.34
24 0.33
25 0.33
26 0.29
27 0.28
28 0.24
29 0.19
30 0.16
31 0.17
32 0.17
33 0.16
34 0.16
35 0.13
36 0.16
37 0.14
38 0.14
39 0.14
40 0.14
41 0.15
42 0.14
43 0.15
44 0.16
45 0.16
46 0.15
47 0.14
48 0.14
49 0.12
50 0.12
51 0.14
52 0.12
53 0.13
54 0.14
55 0.15
56 0.15
57 0.15
58 0.15
59 0.11
60 0.11
61 0.09
62 0.09
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.1
73 0.12
74 0.16
75 0.17
76 0.17
77 0.24
78 0.34
79 0.44
80 0.52
81 0.59
82 0.63
83 0.74
84 0.8
85 0.81
86 0.78
87 0.8
88 0.79
89 0.8
90 0.81
91 0.79
92 0.82
93 0.78
94 0.77
95 0.68
96 0.62
97 0.54