Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SBZ4

Protein Details
Accession A0A2Z6SBZ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-81LKTYIRHIRQSPKKTHWQKGAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, mito_nucl 9.166, cyto 7, mito 3.5
Family & Domain DBs
Amino Acid Sequences MFLLGTFQFSINWEDHYELMHALPVLWNFGKGLNNVIEVLENLRKSHNRNSISSSKTLALKTYIRHIRQSPKKTHWQKGAYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.15
5 0.13
6 0.12
7 0.11
8 0.09
9 0.08
10 0.09
11 0.08
12 0.1
13 0.1
14 0.1
15 0.09
16 0.11
17 0.13
18 0.12
19 0.14
20 0.12
21 0.12
22 0.12
23 0.12
24 0.1
25 0.08
26 0.1
27 0.1
28 0.1
29 0.09
30 0.12
31 0.14
32 0.18
33 0.27
34 0.33
35 0.34
36 0.36
37 0.42
38 0.47
39 0.47
40 0.45
41 0.39
42 0.33
43 0.33
44 0.32
45 0.26
46 0.23
47 0.23
48 0.23
49 0.31
50 0.36
51 0.36
52 0.41
53 0.46
54 0.53
55 0.61
56 0.68
57 0.68
58 0.68
59 0.76
60 0.8
61 0.84
62 0.83