Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SER6

Protein Details
Accession A0A2Z6SER6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-56TPLLHLNKLKHKKKVKQKMLRDSFVFHydrophilic
NLS Segment(s)
PositionSequence
38-69KLKHKKKVKQKMLRDSFVFPLQKKKKSAKRGW
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MNLKGIMALQQQEKRELPIHLHRSKAGGLLTPLLHLNKLKHKKKVKQKMLRDSFVFPLQKKKKSAKRGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.31
4 0.31
5 0.36
6 0.44
7 0.43
8 0.44
9 0.41
10 0.4
11 0.39
12 0.35
13 0.25
14 0.17
15 0.14
16 0.15
17 0.14
18 0.12
19 0.13
20 0.11
21 0.11
22 0.11
23 0.13
24 0.21
25 0.31
26 0.36
27 0.45
28 0.54
29 0.62
30 0.72
31 0.81
32 0.82
33 0.82
34 0.87
35 0.89
36 0.88
37 0.84
38 0.76
39 0.69
40 0.62
41 0.58
42 0.53
43 0.44
44 0.46
45 0.49
46 0.53
47 0.57
48 0.64
49 0.66