Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QKS4

Protein Details
Accession A0A2Z6QKS4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-79QGQVCPDHKKSKSKKNKSRKKTAVSDDLCHydrophilic
NLS Segment(s)
PositionSequence
58-71HKKSKSKKNKSRKK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MHERLMRALTLQTDKIKLTNSRTPLPIKSKKTKDNKSGTTQKTRQSNHPKQGQVCPDHKKSKSKKNKSRKKTAVSDDLCTLLKTLIQKLDGKLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.31
4 0.31
5 0.34
6 0.37
7 0.39
8 0.41
9 0.44
10 0.46
11 0.47
12 0.52
13 0.54
14 0.55
15 0.61
16 0.65
17 0.7
18 0.77
19 0.79
20 0.79
21 0.8
22 0.77
23 0.76
24 0.78
25 0.74
26 0.73
27 0.69
28 0.65
29 0.64
30 0.6
31 0.61
32 0.63
33 0.66
34 0.64
35 0.66
36 0.64
37 0.59
38 0.62
39 0.58
40 0.53
41 0.51
42 0.5
43 0.5
44 0.54
45 0.56
46 0.6
47 0.62
48 0.68
49 0.72
50 0.77
51 0.8
52 0.83
53 0.9
54 0.9
55 0.93
56 0.92
57 0.89
58 0.87
59 0.85
60 0.84
61 0.76
62 0.7
63 0.6
64 0.53
65 0.45
66 0.35
67 0.28
68 0.17
69 0.16
70 0.15
71 0.18
72 0.19
73 0.22
74 0.26
75 0.27