Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RY28

Protein Details
Accession A0A2Z6RY28    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-92MRTRCNSSKKDDKRRSSEKKIKTIIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 4.833
Family & Domain DBs
Amino Acid Sequences MQVYLFDYLIHQNNLMKLTLYRVELIDDVNLFNDSMSEGAYIVNVLAPILACFFNKKKKDYGDTQDMRTRCNSSKKDDKRRSSEKKIKTIIFMREEDRKFSVTEVSGLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.18
4 0.15
5 0.18
6 0.2
7 0.19
8 0.18
9 0.17
10 0.18
11 0.17
12 0.17
13 0.14
14 0.11
15 0.1
16 0.1
17 0.1
18 0.08
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.05
38 0.05
39 0.08
40 0.11
41 0.19
42 0.23
43 0.25
44 0.29
45 0.33
46 0.38
47 0.42
48 0.47
49 0.49
50 0.49
51 0.51
52 0.51
53 0.47
54 0.44
55 0.39
56 0.36
57 0.31
58 0.37
59 0.37
60 0.39
61 0.5
62 0.59
63 0.68
64 0.74
65 0.78
66 0.78
67 0.85
68 0.87
69 0.87
70 0.87
71 0.84
72 0.84
73 0.83
74 0.75
75 0.72
76 0.69
77 0.65
78 0.61
79 0.55
80 0.49
81 0.51
82 0.5
83 0.47
84 0.43
85 0.37
86 0.32
87 0.3
88 0.31
89 0.23