Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1CQY4

Protein Details
Accession A1CQY4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-111GKIVRVRSREGRRNRAPPPRIRYNKDGKKLABasic
NLS Segment(s)
PositionSequence
85-114RVRSREGRRNRAPPPRIRYNKDGKKLAPPQ
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG act:ACLA_027800  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRANNGRNKNGRGHVKPVRCSNCARCTPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNKDGKKLAPPQAAKAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.72
3 0.71
4 0.69
5 0.67
6 0.7
7 0.72
8 0.69
9 0.63
10 0.65
11 0.64
12 0.64
13 0.65
14 0.65
15 0.61
16 0.62
17 0.66
18 0.68
19 0.7
20 0.68
21 0.68
22 0.7
23 0.73
24 0.7
25 0.7
26 0.66
27 0.66
28 0.59
29 0.52
30 0.45
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.08
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.1
54 0.12
55 0.16
56 0.17
57 0.19
58 0.22
59 0.23
60 0.23
61 0.25
62 0.23
63 0.19
64 0.2
65 0.18
66 0.2
67 0.19
68 0.21
69 0.22
70 0.29
71 0.31
72 0.32
73 0.35
74 0.4
75 0.49
76 0.56
77 0.62
78 0.66
79 0.7
80 0.76
81 0.8
82 0.81
83 0.8
84 0.81
85 0.8
86 0.8
87 0.81
88 0.79
89 0.79
90 0.79
91 0.81
92 0.8
93 0.79
94 0.71
95 0.72
96 0.74
97 0.75
98 0.73
99 0.65