Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QYI2

Protein Details
Accession A0A2Z6QYI2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-47QWEKSLHITKRDKRLYRKRRSQDNEPNTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MDTIIRKYWRKYALAYKQWEKSLHITKRDKRLYRKRRSQDNEPNTTPEPSLSRPSSLPGTRRRDDIRRLVYAVGSNYLHSGSLLDYFVSFTPDMREPLSFDINGRYREMDRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.66
4 0.65
5 0.67
6 0.62
7 0.55
8 0.53
9 0.55
10 0.53
11 0.56
12 0.6
13 0.62
14 0.71
15 0.77
16 0.76
17 0.77
18 0.82
19 0.83
20 0.84
21 0.88
22 0.87
23 0.88
24 0.88
25 0.88
26 0.88
27 0.86
28 0.82
29 0.73
30 0.69
31 0.59
32 0.53
33 0.42
34 0.32
35 0.26
36 0.2
37 0.24
38 0.2
39 0.2
40 0.19
41 0.21
42 0.24
43 0.24
44 0.27
45 0.31
46 0.37
47 0.37
48 0.41
49 0.44
50 0.45
51 0.49
52 0.52
53 0.48
54 0.43
55 0.43
56 0.39
57 0.36
58 0.32
59 0.26
60 0.2
61 0.15
62 0.13
63 0.12
64 0.12
65 0.11
66 0.08
67 0.08
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.11
76 0.1
77 0.09
78 0.13
79 0.15
80 0.17
81 0.17
82 0.18
83 0.17
84 0.22
85 0.25
86 0.21
87 0.2
88 0.27
89 0.31
90 0.32
91 0.32
92 0.31
93 0.29