Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RG50

Protein Details
Accession A0A2Z6RG50    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-38WKNPSKMSRTRKANVRKRLRAVHydrophilic
71-95DKYTVFSRKHKGYRKSLHKVPKFTKBasic
NLS Segment(s)
PositionSequence
80-88HKGYRKSLH
Subcellular Location(s) mito 24, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGTFRATLVACGGLLWKNPSKMSRTRKANVRKRLRAVDAVIEAVDKSGVSCKALDYARSLPKESEMLPRDKYTVFSRKHKGYRKSLHKVPKFTKVTIRRTPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.19
5 0.21
6 0.24
7 0.27
8 0.31
9 0.39
10 0.46
11 0.51
12 0.56
13 0.6
14 0.67
15 0.75
16 0.79
17 0.8
18 0.82
19 0.81
20 0.79
21 0.79
22 0.73
23 0.66
24 0.58
25 0.51
26 0.41
27 0.32
28 0.25
29 0.19
30 0.15
31 0.1
32 0.09
33 0.04
34 0.04
35 0.06
36 0.06
37 0.07
38 0.07
39 0.07
40 0.11
41 0.12
42 0.12
43 0.13
44 0.19
45 0.24
46 0.25
47 0.26
48 0.22
49 0.23
50 0.24
51 0.22
52 0.26
53 0.24
54 0.26
55 0.28
56 0.28
57 0.29
58 0.28
59 0.29
60 0.27
61 0.33
62 0.35
63 0.41
64 0.48
65 0.55
66 0.64
67 0.7
68 0.72
69 0.74
70 0.79
71 0.81
72 0.83
73 0.83
74 0.84
75 0.83
76 0.84
77 0.79
78 0.79
79 0.73
80 0.68
81 0.7
82 0.68
83 0.7
84 0.7
85 0.72