Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RZK3

Protein Details
Accession A0A2Z6RZK3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27YCSVIAKKSRENKKKLQKEKATVLSSHydrophilic
NLS Segment(s)
PositionSequence
9-17KSRENKKKL
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MYCSVIAKKSRENKKKLQKEKATVLSSKVLLTDRLTTVKFRSIKNDVKIGISLRVGPQYNDSPLIRCRITAKNLQKLIAITQVSCIRPEYFRKNYSIADGMKVMKVVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.88
4 0.89
5 0.88
6 0.86
7 0.87
8 0.85
9 0.79
10 0.7
11 0.62
12 0.54
13 0.45
14 0.37
15 0.29
16 0.21
17 0.18
18 0.18
19 0.18
20 0.16
21 0.18
22 0.18
23 0.18
24 0.19
25 0.25
26 0.27
27 0.25
28 0.29
29 0.34
30 0.4
31 0.42
32 0.44
33 0.38
34 0.35
35 0.35
36 0.3
37 0.24
38 0.18
39 0.15
40 0.12
41 0.14
42 0.13
43 0.12
44 0.14
45 0.14
46 0.15
47 0.17
48 0.16
49 0.16
50 0.17
51 0.2
52 0.17
53 0.17
54 0.2
55 0.22
56 0.26
57 0.33
58 0.4
59 0.45
60 0.47
61 0.47
62 0.44
63 0.39
64 0.37
65 0.33
66 0.26
67 0.17
68 0.2
69 0.24
70 0.23
71 0.23
72 0.23
73 0.19
74 0.23
75 0.3
76 0.35
77 0.38
78 0.41
79 0.44
80 0.46
81 0.46
82 0.47
83 0.46
84 0.38
85 0.33
86 0.33
87 0.31
88 0.28
89 0.27