Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RYU6

Protein Details
Accession A0A2Z6RYU6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66RWWDRMNKGKQWKDIKDRFSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, golg 7, extr 4, E.R. 4, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MTYRNSALEKYSRGVYRTIFRRNTVFLAGIFATAFAFEMAFDTVTDRWWDRMNKGKQWKDIKDRFSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.35
4 0.4
5 0.46
6 0.43
7 0.43
8 0.44
9 0.44
10 0.43
11 0.36
12 0.3
13 0.2
14 0.2
15 0.17
16 0.14
17 0.11
18 0.09
19 0.07
20 0.06
21 0.06
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.08
32 0.1
33 0.1
34 0.11
35 0.17
36 0.19
37 0.23
38 0.33
39 0.39
40 0.47
41 0.57
42 0.63
43 0.66
44 0.74
45 0.78
46 0.79
47 0.8