Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S640

Protein Details
Accession A0A2Z6S640    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-127KTISEKEKKKKGGHNYSGKKDNHYAKTRSWKEKDLKKERITSERRBasic
NLS Segment(s)
PositionSequence
88-127KEKKKKGGHNYSGKKDNHYAKTRSWKEKDLKKERITSERR
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
Amino Acid Sequences MYKVQIPTTSTKINIPKYIEIGKLIGREGCNLKPIEEETGTRIKVNTDTKPAHIEIKINEKITLLSCKDRVKEASNKLNNLMKTISEKEKKKKGGHNYSGKKDNHYAKTRSWKEKDLKKERITSERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.43
4 0.44
5 0.46
6 0.41
7 0.35
8 0.31
9 0.28
10 0.24
11 0.23
12 0.21
13 0.18
14 0.2
15 0.22
16 0.22
17 0.24
18 0.23
19 0.23
20 0.22
21 0.22
22 0.23
23 0.2
24 0.2
25 0.19
26 0.24
27 0.23
28 0.22
29 0.21
30 0.18
31 0.22
32 0.26
33 0.25
34 0.27
35 0.28
36 0.3
37 0.33
38 0.32
39 0.29
40 0.26
41 0.25
42 0.2
43 0.27
44 0.28
45 0.26
46 0.25
47 0.22
48 0.22
49 0.21
50 0.23
51 0.16
52 0.15
53 0.18
54 0.2
55 0.21
56 0.23
57 0.24
58 0.26
59 0.32
60 0.37
61 0.43
62 0.45
63 0.45
64 0.47
65 0.48
66 0.43
67 0.37
68 0.3
69 0.21
70 0.22
71 0.25
72 0.3
73 0.33
74 0.4
75 0.47
76 0.55
77 0.63
78 0.66
79 0.7
80 0.73
81 0.76
82 0.79
83 0.81
84 0.81
85 0.81
86 0.83
87 0.75
88 0.69
89 0.66
90 0.65
91 0.64
92 0.63
93 0.59
94 0.58
95 0.68
96 0.72
97 0.74
98 0.71
99 0.71
100 0.73
101 0.78
102 0.81
103 0.8
104 0.81
105 0.78
106 0.82
107 0.8