Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R8V9

Protein Details
Accession A0A2Z6R8V9    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-87VKPAQKTHSRYRRATRCCRWEKKTNHGRTYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, E.R. 5, mito 3, cyto 3, extr 3, golg 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDRENEPMSETDILPSVDVVKKGWKKHDRNFLSSSVIFVIIPNTYLFLCLFFLLLIVKPAQKTHSRYRRATRCCRWEKKTNHGRTYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.14
6 0.14
7 0.21
8 0.26
9 0.31
10 0.41
11 0.48
12 0.54
13 0.62
14 0.72
15 0.69
16 0.69
17 0.68
18 0.6
19 0.55
20 0.46
21 0.39
22 0.28
23 0.23
24 0.17
25 0.13
26 0.12
27 0.06
28 0.07
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.08
45 0.08
46 0.09
47 0.13
48 0.19
49 0.25
50 0.35
51 0.44
52 0.51
53 0.58
54 0.68
55 0.75
56 0.78
57 0.83
58 0.82
59 0.83
60 0.86
61 0.89
62 0.86
63 0.86
64 0.84
65 0.85
66 0.85
67 0.85