Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QIH7

Protein Details
Accession A0A2Z6QIH7    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MISPPKYKSIKKNPDKNKSVKRSNENFQAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 4
Family & Domain DBs
Amino Acid Sequences MISPPKYKSIKKNPDKNKSVKRSNENFQAEENELKQIKVDVTDTLTGEILLMKERTVIYRIILNSKSERLLCNNLPGGIVIFVHNNDDDFHCVIFLTQVEFVRKYLLMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.89
5 0.88
6 0.87
7 0.86
8 0.85
9 0.82
10 0.81
11 0.8
12 0.74
13 0.65
14 0.57
15 0.52
16 0.44
17 0.39
18 0.32
19 0.27
20 0.23
21 0.21
22 0.19
23 0.17
24 0.15
25 0.13
26 0.14
27 0.09
28 0.11
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.07
42 0.07
43 0.09
44 0.09
45 0.08
46 0.11
47 0.12
48 0.16
49 0.17
50 0.18
51 0.19
52 0.2
53 0.21
54 0.19
55 0.2
56 0.2
57 0.24
58 0.23
59 0.26
60 0.26
61 0.24
62 0.23
63 0.21
64 0.18
65 0.12
66 0.12
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.09
73 0.1
74 0.11
75 0.14
76 0.14
77 0.14
78 0.12
79 0.12
80 0.11
81 0.12
82 0.1
83 0.09
84 0.12
85 0.15
86 0.18
87 0.2
88 0.2
89 0.22