Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RSZ8

Protein Details
Accession A0A2Z6RSZ8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-98EGNRRYKLKNKQLLQERKKKLBasic
NLS Segment(s)
PositionSequence
94-96RKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Gene Ontology GO:0007229  P:integrin-mediated signaling pathway  
Amino Acid Sequences MRGVSNHKRFLEIMKNPPRKLNYKVEDLILDIYNNNPYILYLRNERVQIKRAKNYAGRSMWHDEPAEIKEFYKLIALEGNRRYKLKNKQLLQERKKKLTPLRPQPQPPPPPQPQPQTQSPQPPPPPTYYPQLQPPPPQPQLPPIQSLYPQLPPIQLLHPQLPSIQSLYPQLPPIQSLYPQLPPIHSPYPRLPPLQSSRPQLPPLQLLQPKPPPYTPHVYYEYFQPQQQQQPPPPPSTTYLKVQPMPLPPPTCQLRDAKQFHQFHSCCARRQNQFRAEPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.65
4 0.71
5 0.7
6 0.66
7 0.65
8 0.65
9 0.6
10 0.6
11 0.6
12 0.55
13 0.49
14 0.44
15 0.4
16 0.3
17 0.24
18 0.16
19 0.15
20 0.16
21 0.16
22 0.14
23 0.11
24 0.11
25 0.12
26 0.15
27 0.17
28 0.2
29 0.24
30 0.28
31 0.32
32 0.36
33 0.39
34 0.44
35 0.5
36 0.53
37 0.57
38 0.57
39 0.6
40 0.62
41 0.62
42 0.63
43 0.58
44 0.51
45 0.49
46 0.51
47 0.46
48 0.43
49 0.37
50 0.29
51 0.28
52 0.28
53 0.26
54 0.2
55 0.18
56 0.17
57 0.16
58 0.16
59 0.16
60 0.13
61 0.11
62 0.15
63 0.16
64 0.21
65 0.28
66 0.34
67 0.34
68 0.35
69 0.37
70 0.41
71 0.5
72 0.54
73 0.56
74 0.55
75 0.61
76 0.71
77 0.8
78 0.8
79 0.81
80 0.77
81 0.75
82 0.73
83 0.71
84 0.69
85 0.69
86 0.69
87 0.7
88 0.72
89 0.73
90 0.76
91 0.76
92 0.77
93 0.74
94 0.69
95 0.67
96 0.63
97 0.63
98 0.63
99 0.61
100 0.58
101 0.56
102 0.57
103 0.54
104 0.53
105 0.54
106 0.52
107 0.54
108 0.52
109 0.51
110 0.47
111 0.45
112 0.45
113 0.39
114 0.4
115 0.34
116 0.32
117 0.35
118 0.38
119 0.36
120 0.36
121 0.38
122 0.41
123 0.41
124 0.4
125 0.34
126 0.33
127 0.37
128 0.35
129 0.32
130 0.25
131 0.24
132 0.23
133 0.25
134 0.22
135 0.17
136 0.16
137 0.14
138 0.13
139 0.13
140 0.14
141 0.13
142 0.15
143 0.16
144 0.17
145 0.17
146 0.17
147 0.17
148 0.16
149 0.15
150 0.13
151 0.11
152 0.1
153 0.12
154 0.13
155 0.14
156 0.14
157 0.14
158 0.13
159 0.13
160 0.15
161 0.14
162 0.13
163 0.14
164 0.15
165 0.15
166 0.17
167 0.17
168 0.16
169 0.16
170 0.21
171 0.25
172 0.24
173 0.27
174 0.3
175 0.37
176 0.39
177 0.4
178 0.35
179 0.36
180 0.42
181 0.46
182 0.47
183 0.45
184 0.47
185 0.5
186 0.51
187 0.47
188 0.42
189 0.38
190 0.35
191 0.38
192 0.37
193 0.34
194 0.39
195 0.44
196 0.46
197 0.45
198 0.45
199 0.41
200 0.43
201 0.48
202 0.44
203 0.43
204 0.43
205 0.42
206 0.4
207 0.43
208 0.44
209 0.38
210 0.36
211 0.36
212 0.35
213 0.42
214 0.49
215 0.5
216 0.49
217 0.57
218 0.6
219 0.59
220 0.57
221 0.51
222 0.48
223 0.47
224 0.44
225 0.4
226 0.43
227 0.45
228 0.45
229 0.46
230 0.46
231 0.45
232 0.46
233 0.47
234 0.43
235 0.39
236 0.43
237 0.45
238 0.42
239 0.4
240 0.42
241 0.43
242 0.5
243 0.55
244 0.54
245 0.59
246 0.61
247 0.6
248 0.64
249 0.57
250 0.54
251 0.59
252 0.57
253 0.53
254 0.58
255 0.63
256 0.62
257 0.72
258 0.75
259 0.74