Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R0F9

Protein Details
Accession A0A2Z6R0F9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-26RSDILRKKKKSEIEKSEKLYKQBasic
NLS Segment(s)
PositionSequence
12-13KK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.333, cyto 3, cyto_mito 2.333, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNQLRSDILRKKKKSEIEKSEKLYKQNHIAVPIQYYKSTDISLKLLWKKIMVVIWLMIDIMISDDNEAFTQTQGDENDNIDSTEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.77
4 0.77
5 0.8
6 0.8
7 0.81
8 0.76
9 0.71
10 0.65
11 0.59
12 0.56
13 0.54
14 0.5
15 0.43
16 0.42
17 0.38
18 0.36
19 0.34
20 0.28
21 0.22
22 0.21
23 0.19
24 0.18
25 0.18
26 0.15
27 0.13
28 0.14
29 0.14
30 0.18
31 0.19
32 0.2
33 0.2
34 0.19
35 0.18
36 0.18
37 0.18
38 0.14
39 0.12
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.11
60 0.12
61 0.15
62 0.15
63 0.16
64 0.18
65 0.18