Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RKJ7

Protein Details
Accession A0A2Z6RKJ7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-72PTQAKLTPKGKGKKKNKHKKVPTVNPDFAGHydrophilic
NLS Segment(s)
PositionSequence
50-62PKGKGKKKNKHKK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, cyto 5.5, cyto_pero 4.832
Family & Domain DBs
Amino Acid Sequences MQDPPKIGDINNTLNTPESVMIQEIDMDISSPAQHQSNPVALPTQAKLTPKGKGKKKNKHKKVPTVNPDFAGSWDKEPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.24
4 0.19
5 0.13
6 0.11
7 0.11
8 0.1
9 0.09
10 0.09
11 0.07
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.07
21 0.07
22 0.08
23 0.1
24 0.12
25 0.12
26 0.12
27 0.11
28 0.11
29 0.12
30 0.11
31 0.12
32 0.12
33 0.13
34 0.18
35 0.19
36 0.25
37 0.33
38 0.41
39 0.47
40 0.56
41 0.66
42 0.72
43 0.81
44 0.87
45 0.89
46 0.91
47 0.93
48 0.94
49 0.94
50 0.94
51 0.93
52 0.91
53 0.84
54 0.74
55 0.67
56 0.56
57 0.47
58 0.41
59 0.33