Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QZU4

Protein Details
Accession A0A2Z6QZU4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-82KPFKDQAKSSKKSKNKKKKKSLGKKSNDKIYIVHydrophilic
NLS Segment(s)
PositionSequence
43-74KARSTNSKPFKDQAKSSKKSKNKKKKKSLGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTFNFNYNSTDHSFPWCASPISFQNKNKKSMKDSNKQSFSSPKARSTNSKPFKDQAKSSKKSKNKKKKKSLGKKSNDKIYIVKLLLALIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.23
5 0.2
6 0.24
7 0.26
8 0.33
9 0.4
10 0.44
11 0.52
12 0.56
13 0.64
14 0.65
15 0.63
16 0.63
17 0.65
18 0.68
19 0.67
20 0.72
21 0.74
22 0.73
23 0.69
24 0.64
25 0.59
26 0.55
27 0.54
28 0.47
29 0.44
30 0.42
31 0.43
32 0.46
33 0.48
34 0.54
35 0.54
36 0.55
37 0.51
38 0.51
39 0.56
40 0.55
41 0.54
42 0.53
43 0.55
44 0.57
45 0.62
46 0.67
47 0.68
48 0.74
49 0.79
50 0.8
51 0.81
52 0.87
53 0.91
54 0.92
55 0.94
56 0.95
57 0.95
58 0.95
59 0.94
60 0.94
61 0.91
62 0.91
63 0.83
64 0.75
65 0.67
66 0.62
67 0.58
68 0.48
69 0.4
70 0.31