Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S5K6

Protein Details
Accession A0A2Z6S5K6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
110-137FNLAINYEKWRRNRKKFRKSLLLVSKSSHydrophilic
NLS Segment(s)
PositionSequence
119-130WRRNRKKFRKSL
Subcellular Location(s) mito 12, cyto_nucl 8.5, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MFNLAINYKNGEGTEKNLEKAFYWYQKAAENGNEKAMVNLANCYENGEGTEKNLEKAFYWYQKAAENDVKEAMFNLAINYKNGEGTEKNLEKAFYWYQKAAENDVKEAMFNLAINYEKWRRNRKKFRKSLLLVSKSSRKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.31
5 0.31
6 0.28
7 0.32
8 0.35
9 0.31
10 0.33
11 0.33
12 0.33
13 0.36
14 0.37
15 0.34
16 0.33
17 0.32
18 0.29
19 0.3
20 0.29
21 0.25
22 0.23
23 0.22
24 0.17
25 0.12
26 0.12
27 0.11
28 0.11
29 0.1
30 0.13
31 0.12
32 0.1
33 0.11
34 0.12
35 0.11
36 0.11
37 0.17
38 0.15
39 0.17
40 0.18
41 0.18
42 0.17
43 0.23
44 0.29
45 0.29
46 0.33
47 0.33
48 0.33
49 0.36
50 0.36
51 0.35
52 0.31
53 0.26
54 0.22
55 0.22
56 0.2
57 0.16
58 0.15
59 0.11
60 0.07
61 0.06
62 0.06
63 0.08
64 0.08
65 0.09
66 0.11
67 0.12
68 0.13
69 0.14
70 0.18
71 0.16
72 0.2
73 0.3
74 0.3
75 0.31
76 0.31
77 0.31
78 0.28
79 0.32
80 0.35
81 0.31
82 0.33
83 0.33
84 0.33
85 0.36
86 0.36
87 0.35
88 0.31
89 0.26
90 0.22
91 0.22
92 0.2
93 0.16
94 0.15
95 0.11
96 0.07
97 0.06
98 0.06
99 0.06
100 0.08
101 0.09
102 0.14
103 0.21
104 0.27
105 0.35
106 0.47
107 0.56
108 0.66
109 0.77
110 0.83
111 0.87
112 0.92
113 0.94
114 0.94
115 0.89
116 0.89
117 0.88
118 0.83
119 0.76
120 0.72