Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SGT7

Protein Details
Accession A0A2Z6SGT7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-108HAWEKARNITRKKKIKYRRTNKKAILPKTRIPHydrophilic
NLS Segment(s)
PositionSequence
82-104ARNITRKKKIKYRRTNKKAILPK
Subcellular Location(s) nucl 11, mito 7, cyto 6, pero 3
Family & Domain DBs
Amino Acid Sequences MDIRAWVERSQIFSLVTNDDHPVYLVLHQCVPSTLTSLIKIFIKNTKERHAMIIFFMELFFKDITRPFWKLHSSLMHAWEKARNITRKKKIKYRRTNKKAILPKTRIPPLVNLEIRDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.19
5 0.19
6 0.18
7 0.17
8 0.15
9 0.13
10 0.11
11 0.14
12 0.15
13 0.15
14 0.16
15 0.16
16 0.16
17 0.16
18 0.16
19 0.13
20 0.13
21 0.13
22 0.12
23 0.13
24 0.13
25 0.14
26 0.15
27 0.15
28 0.14
29 0.19
30 0.22
31 0.26
32 0.3
33 0.35
34 0.37
35 0.37
36 0.4
37 0.36
38 0.32
39 0.27
40 0.24
41 0.17
42 0.13
43 0.12
44 0.08
45 0.06
46 0.07
47 0.06
48 0.05
49 0.06
50 0.08
51 0.12
52 0.16
53 0.18
54 0.18
55 0.22
56 0.24
57 0.24
58 0.28
59 0.27
60 0.28
61 0.28
62 0.33
63 0.32
64 0.3
65 0.3
66 0.29
67 0.27
68 0.28
69 0.33
70 0.35
71 0.41
72 0.52
73 0.6
74 0.67
75 0.74
76 0.79
77 0.82
78 0.86
79 0.88
80 0.89
81 0.9
82 0.89
83 0.92
84 0.89
85 0.88
86 0.87
87 0.86
88 0.85
89 0.8
90 0.78
91 0.77
92 0.76
93 0.71
94 0.63
95 0.6
96 0.56
97 0.59
98 0.55