Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SG11

Protein Details
Accession A0A2Z6SG11    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-81HVLDVKHFDKKKKKKKNNNSGTFLKHKBasic
NLS Segment(s)
PositionSequence
64-70KKKKKKK
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MKLLLDLRCLLELRLPKCASTRNKSNIIIFKKVIVSHKFNIIILSKKKNSSFFNHVLDVKHFDKKKKKKKNNNSGTFLKHKFLTVSSCSTFTSLLKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.29
4 0.32
5 0.4
6 0.44
7 0.45
8 0.53
9 0.51
10 0.57
11 0.59
12 0.62
13 0.62
14 0.59
15 0.55
16 0.46
17 0.41
18 0.37
19 0.37
20 0.37
21 0.34
22 0.34
23 0.3
24 0.35
25 0.33
26 0.31
27 0.3
28 0.26
29 0.27
30 0.26
31 0.31
32 0.29
33 0.31
34 0.33
35 0.36
36 0.37
37 0.37
38 0.4
39 0.38
40 0.39
41 0.39
42 0.38
43 0.34
44 0.33
45 0.32
46 0.27
47 0.29
48 0.29
49 0.34
50 0.44
51 0.53
52 0.63
53 0.69
54 0.78
55 0.83
56 0.91
57 0.95
58 0.95
59 0.94
60 0.9
61 0.85
62 0.81
63 0.79
64 0.7
65 0.62
66 0.52
67 0.43
68 0.37
69 0.33
70 0.32
71 0.27
72 0.3
73 0.29
74 0.3
75 0.29
76 0.29
77 0.28