Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QG23

Protein Details
Accession A0A2Z6QG23    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MTRNYSLRKHSRNKQKRRERLERKFDTKAKNKGBasic
NLS Segment(s)
PositionSequence
8-34RKHSRNKQKRRERLERKFDTKAKNKGI
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, mito_nucl 11.166, mito 6.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MTRNYSLRKHSRNKQKRRERLERKFDTKAKNKGIDEPTTSKAKKNWHHINKNVYHFFKPVSHFKKSKHSKQKDLLPFLPKQTIIKKRAAGKPLVPLPPMTKQDWKIHVAKGFEQIDAERKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.92
5 0.94
6 0.94
7 0.94
8 0.93
9 0.92
10 0.88
11 0.87
12 0.84
13 0.83
14 0.8
15 0.79
16 0.76
17 0.74
18 0.68
19 0.67
20 0.64
21 0.58
22 0.54
23 0.49
24 0.45
25 0.45
26 0.44
27 0.39
28 0.38
29 0.43
30 0.44
31 0.5
32 0.58
33 0.61
34 0.69
35 0.72
36 0.77
37 0.75
38 0.75
39 0.71
40 0.62
41 0.53
42 0.45
43 0.41
44 0.35
45 0.32
46 0.34
47 0.33
48 0.37
49 0.38
50 0.4
51 0.5
52 0.54
53 0.61
54 0.63
55 0.65
56 0.68
57 0.72
58 0.79
59 0.76
60 0.75
61 0.69
62 0.63
63 0.58
64 0.51
65 0.46
66 0.37
67 0.32
68 0.34
69 0.38
70 0.37
71 0.41
72 0.44
73 0.5
74 0.55
75 0.56
76 0.51
77 0.45
78 0.49
79 0.5
80 0.48
81 0.41
82 0.36
83 0.36
84 0.4
85 0.41
86 0.37
87 0.37
88 0.39
89 0.47
90 0.5
91 0.51
92 0.48
93 0.49
94 0.5
95 0.46
96 0.43
97 0.44
98 0.4
99 0.35
100 0.33
101 0.29
102 0.32