Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RAH3

Protein Details
Accession A0A2Z6RAH3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-67TLLTKSQKRNAKKKARKEKQKLQLQSPHydrophilic
NLS Segment(s)
PositionSequence
47-60QKRNAKKKARKEKQ
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MHQSDTLMNFDVFDTNLIGSLDDVDKLFITSPRNITPIPVTLLTKSQKRNAKKKARKEKQKLQLQSPSGLDEQVVHTFSTESPEYTPSKPSGSRTITFNQSLLSHLSHPTSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.1
4 0.09
5 0.09
6 0.08
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.09
15 0.1
16 0.13
17 0.16
18 0.19
19 0.2
20 0.23
21 0.22
22 0.23
23 0.22
24 0.21
25 0.2
26 0.19
27 0.18
28 0.16
29 0.21
30 0.23
31 0.27
32 0.28
33 0.32
34 0.38
35 0.46
36 0.55
37 0.6
38 0.69
39 0.72
40 0.8
41 0.84
42 0.87
43 0.9
44 0.9
45 0.89
46 0.88
47 0.88
48 0.81
49 0.77
50 0.74
51 0.64
52 0.58
53 0.48
54 0.4
55 0.31
56 0.27
57 0.2
58 0.13
59 0.13
60 0.12
61 0.12
62 0.1
63 0.1
64 0.1
65 0.1
66 0.14
67 0.12
68 0.12
69 0.12
70 0.15
71 0.18
72 0.19
73 0.22
74 0.2
75 0.24
76 0.25
77 0.28
78 0.34
79 0.37
80 0.37
81 0.39
82 0.43
83 0.44
84 0.43
85 0.39
86 0.33
87 0.27
88 0.27
89 0.25
90 0.22
91 0.18
92 0.18
93 0.21