Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QU61

Protein Details
Accession A0A2Z6QU61    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
58-81EILDAKKKRKKTAMNKKAKKLSFKBasic
NLS Segment(s)
PositionSequence
61-77DAKKKRKKTAMNKKAKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR044044  DUF5679  
Pfam View protein in Pfam  
PF18930  DUF5679  
Amino Acid Sequences MTEIYCVKFKKKTETSSKVQDMTDKGRYRIHGDCIICGTYKNTLTGENWEVKTHSKREILDAKKKRKKTAMNKKAKKLSFKILDANENVQTYIKRYLRDATKED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.74
4 0.75
5 0.67
6 0.6
7 0.55
8 0.48
9 0.47
10 0.49
11 0.42
12 0.38
13 0.39
14 0.4
15 0.4
16 0.39
17 0.38
18 0.36
19 0.33
20 0.32
21 0.3
22 0.29
23 0.24
24 0.21
25 0.17
26 0.14
27 0.14
28 0.14
29 0.13
30 0.13
31 0.14
32 0.17
33 0.19
34 0.19
35 0.19
36 0.18
37 0.19
38 0.21
39 0.24
40 0.22
41 0.24
42 0.24
43 0.23
44 0.29
45 0.38
46 0.41
47 0.48
48 0.55
49 0.61
50 0.66
51 0.7
52 0.71
53 0.7
54 0.74
55 0.75
56 0.77
57 0.77
58 0.8
59 0.85
60 0.88
61 0.88
62 0.83
63 0.79
64 0.73
65 0.72
66 0.68
67 0.62
68 0.6
69 0.54
70 0.55
71 0.49
72 0.47
73 0.4
74 0.33
75 0.31
76 0.25
77 0.22
78 0.21
79 0.28
80 0.27
81 0.26
82 0.28
83 0.36
84 0.43