Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LC26

Protein Details
Accession E2LC26    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-32IVDSNRCKPKRCAQECKKSCPVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017896  4Fe4S_Fe-S-bd  
IPR017900  4Fe4S_Fe_S_CS  
IPR027417  P-loop_NTPase  
IPR013283  RLI1  
IPR007209  RNaseL-inhib-like_metal-bd_dom  
KEGG mpr:MPER_03740  -  
Pfam View protein in Pfam  
PF00037  Fer4  
PF04068  RLI  
PROSITE View protein in PROSITE  
PS00198  4FE4S_FER_1  
PS51379  4FE4S_FER_2  
Amino Acid Sequences MTDKITRIAIVDSNRCKPKRCAQECKKSCPVVRMGKLCIEVKPTDKIAFISEILCIGCGICVKKCPFEAIAIINLPTNLESEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.54
4 0.56
5 0.6
6 0.62
7 0.66
8 0.69
9 0.71
10 0.8
11 0.81
12 0.83
13 0.81
14 0.76
15 0.68
16 0.61
17 0.59
18 0.57
19 0.57
20 0.51
21 0.45
22 0.42
23 0.43
24 0.39
25 0.32
26 0.26
27 0.21
28 0.2
29 0.21
30 0.19
31 0.17
32 0.16
33 0.16
34 0.14
35 0.15
36 0.13
37 0.11
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.05
44 0.05
45 0.07
46 0.09
47 0.09
48 0.15
49 0.17
50 0.21
51 0.22
52 0.25
53 0.24
54 0.25
55 0.27
56 0.23
57 0.25
58 0.22
59 0.22
60 0.19
61 0.18
62 0.16
63 0.13