Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RD47

Protein Details
Accession A0A2Z6RD47    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-36TSLNNNPNNQRQQRQRNNNNKPTKKKLLITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
Amino Acid Sequences MKSQTNTSLNNNPNNQRQQRQRNNNNKPTKKKLLITFKNQSSADNIFENNIWYKTIDYINVRILSANQTSEEYIKRTECSYKITSIPLNATSQDLKPILTKIDVHSQPLHVDKVSKQLTSTYQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.68
4 0.73
5 0.76
6 0.8
7 0.85
8 0.87
9 0.88
10 0.91
11 0.93
12 0.93
13 0.92
14 0.9
15 0.88
16 0.87
17 0.82
18 0.78
19 0.77
20 0.77
21 0.75
22 0.75
23 0.74
24 0.67
25 0.67
26 0.6
27 0.51
28 0.44
29 0.39
30 0.32
31 0.24
32 0.21
33 0.16
34 0.16
35 0.16
36 0.14
37 0.12
38 0.1
39 0.09
40 0.1
41 0.11
42 0.11
43 0.13
44 0.12
45 0.14
46 0.16
47 0.17
48 0.16
49 0.14
50 0.14
51 0.14
52 0.13
53 0.12
54 0.09
55 0.09
56 0.1
57 0.12
58 0.12
59 0.11
60 0.12
61 0.13
62 0.13
63 0.14
64 0.18
65 0.18
66 0.23
67 0.24
68 0.24
69 0.25
70 0.27
71 0.27
72 0.25
73 0.26
74 0.22
75 0.2
76 0.18
77 0.19
78 0.18
79 0.17
80 0.19
81 0.17
82 0.16
83 0.16
84 0.17
85 0.17
86 0.17
87 0.18
88 0.17
89 0.27
90 0.27
91 0.3
92 0.31
93 0.3
94 0.32
95 0.34
96 0.33
97 0.24
98 0.26
99 0.23
100 0.31
101 0.33
102 0.3
103 0.27
104 0.29