Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QY46

Protein Details
Accession A0A2Z6QY46    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-47ASTRKEGCKIHWKRRQRNSCKQCGKPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MRAEFICQYISNEGNVCGRASTRKEGCKIHWKRRQRNSCKQCGKPTTSIHGMCNLHVDKYYSKTYYHRKKLNALEKSALEKSALGNFQLSEAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.13
5 0.14
6 0.18
7 0.22
8 0.29
9 0.33
10 0.38
11 0.42
12 0.46
13 0.51
14 0.56
15 0.61
16 0.63
17 0.66
18 0.71
19 0.76
20 0.83
21 0.88
22 0.87
23 0.89
24 0.88
25 0.89
26 0.88
27 0.84
28 0.82
29 0.77
30 0.72
31 0.67
32 0.61
33 0.55
34 0.51
35 0.46
36 0.38
37 0.38
38 0.33
39 0.27
40 0.29
41 0.24
42 0.19
43 0.18
44 0.2
45 0.15
46 0.18
47 0.22
48 0.18
49 0.2
50 0.27
51 0.37
52 0.46
53 0.54
54 0.56
55 0.57
56 0.64
57 0.72
58 0.75
59 0.71
60 0.65
61 0.6
62 0.55
63 0.57
64 0.49
65 0.4
66 0.3
67 0.25
68 0.22
69 0.24
70 0.23
71 0.18
72 0.18
73 0.17
74 0.17
75 0.17