Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RCL2

Protein Details
Accession A0A2Z6RCL2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-42HHKFSHNPYKHKLNNKQRLSSKPTNLKPQNKRTSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEIRQAEHHKFSHNPYKHKLNNKQRLSSKPTNLKPQNKRTSHLTGANTVALGKRIKSALTTNSPSKDISDNSSTSSSSNSLTNHNDGIVGGLASLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.65
4 0.68
5 0.74
6 0.77
7 0.78
8 0.81
9 0.81
10 0.83
11 0.79
12 0.79
13 0.78
14 0.76
15 0.74
16 0.73
17 0.71
18 0.73
19 0.75
20 0.78
21 0.78
22 0.8
23 0.81
24 0.73
25 0.71
26 0.66
27 0.64
28 0.58
29 0.55
30 0.46
31 0.38
32 0.36
33 0.33
34 0.26
35 0.2
36 0.15
37 0.12
38 0.1
39 0.08
40 0.09
41 0.09
42 0.1
43 0.11
44 0.14
45 0.17
46 0.23
47 0.27
48 0.29
49 0.31
50 0.32
51 0.31
52 0.3
53 0.28
54 0.23
55 0.23
56 0.24
57 0.22
58 0.24
59 0.25
60 0.24
61 0.21
62 0.21
63 0.17
64 0.15
65 0.17
66 0.16
67 0.19
68 0.23
69 0.25
70 0.24
71 0.23
72 0.22
73 0.19
74 0.19
75 0.14
76 0.1