Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QYU8

Protein Details
Accession A0A2Z6QYU8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-67RICIEFYKSKPKPKPKPQYHNNWELYHydrophilic
NLS Segment(s)
PositionSequence
97-105AKRIAKARK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPVRNFYNKVRRDAELLDYNNDIVVNQFLRGLNKDCIIEAERICIEFYKSKPKPKPKPQYHNNWELYAQNPYPDESSNLFNEDINHNDDDRHLHKIAKRIAKARKKYDDTELNKAMRELSLDDHDNSMNTSNTIRGMPIELVQADPCANVFFIQEEAVPELKLKTDKSIKHNIIGVSGLSEILGIRGQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.45
4 0.4
5 0.37
6 0.34
7 0.3
8 0.27
9 0.19
10 0.12
11 0.12
12 0.1
13 0.09
14 0.12
15 0.13
16 0.15
17 0.19
18 0.23
19 0.22
20 0.24
21 0.24
22 0.21
23 0.23
24 0.23
25 0.24
26 0.2
27 0.21
28 0.19
29 0.19
30 0.2
31 0.17
32 0.17
33 0.19
34 0.21
35 0.29
36 0.33
37 0.42
38 0.52
39 0.62
40 0.7
41 0.76
42 0.85
43 0.85
44 0.91
45 0.9
46 0.92
47 0.88
48 0.87
49 0.78
50 0.69
51 0.59
52 0.49
53 0.42
54 0.35
55 0.28
56 0.19
57 0.17
58 0.16
59 0.16
60 0.15
61 0.16
62 0.13
63 0.16
64 0.15
65 0.16
66 0.16
67 0.15
68 0.16
69 0.15
70 0.15
71 0.15
72 0.15
73 0.13
74 0.13
75 0.13
76 0.15
77 0.15
78 0.18
79 0.16
80 0.18
81 0.2
82 0.27
83 0.34
84 0.36
85 0.38
86 0.41
87 0.5
88 0.56
89 0.62
90 0.64
91 0.66
92 0.64
93 0.64
94 0.64
95 0.64
96 0.6
97 0.6
98 0.57
99 0.48
100 0.44
101 0.41
102 0.34
103 0.24
104 0.2
105 0.13
106 0.11
107 0.13
108 0.15
109 0.15
110 0.16
111 0.16
112 0.15
113 0.14
114 0.14
115 0.11
116 0.1
117 0.09
118 0.09
119 0.1
120 0.1
121 0.1
122 0.08
123 0.1
124 0.1
125 0.1
126 0.11
127 0.1
128 0.11
129 0.11
130 0.11
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.11
144 0.12
145 0.11
146 0.11
147 0.11
148 0.14
149 0.17
150 0.16
151 0.22
152 0.29
153 0.36
154 0.42
155 0.53
156 0.53
157 0.54
158 0.58
159 0.5
160 0.44
161 0.38
162 0.31
163 0.22
164 0.19
165 0.14
166 0.1
167 0.09
168 0.07
169 0.07