Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QRH9

Protein Details
Accession A0A2Z6QRH9    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-82ALPTIDKKEKKVKRRRTPYAWDDKLRBasic
NLS Segment(s)
PositionSequence
63-73KKEKKVKRRRT
89-97KKKSDKKGK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MTTSAASNSVLGDKNDKLSTSFSEEPSLNKSNKNTLIDSSKKSFEDKEDQQHVKFGALPTIDKKEKKVKRRRTPYAWDDKLRPIFDDDKKKSDKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.21
5 0.21
6 0.23
7 0.27
8 0.29
9 0.26
10 0.28
11 0.28
12 0.28
13 0.31
14 0.33
15 0.27
16 0.27
17 0.28
18 0.32
19 0.37
20 0.38
21 0.33
22 0.32
23 0.38
24 0.38
25 0.4
26 0.36
27 0.34
28 0.31
29 0.31
30 0.29
31 0.26
32 0.3
33 0.3
34 0.34
35 0.39
36 0.4
37 0.38
38 0.39
39 0.35
40 0.28
41 0.26
42 0.18
43 0.14
44 0.13
45 0.14
46 0.14
47 0.21
48 0.25
49 0.24
50 0.29
51 0.36
52 0.44
53 0.54
54 0.62
55 0.66
56 0.73
57 0.83
58 0.88
59 0.87
60 0.89
61 0.88
62 0.89
63 0.85
64 0.79
65 0.72
66 0.71
67 0.69
68 0.6
69 0.51
70 0.45
71 0.46
72 0.49
73 0.56
74 0.53
75 0.54
76 0.61
77 0.64