Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2L9T6

Protein Details
Accession E2L9T6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MEKIKKEEEKKRKLLEREEAERKRBasic
35-54EEERERQRQRKKEEEEKTLEAcidic
NLS Segment(s)
PositionSequence
4-74IKKEEEKKRKLLEREEAERKREIELRKKRFEEEERERQRQRKKEEEEKTLEAVRQKRAEEEKNKLLYGKPR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG mpr:MPER_02790  -  
Amino Acid Sequences MEKIKKEEEKKRKLLEREEAERKREIELRKKRFEEEERERQRQRKKEEEEKTLEAVRQKRAEEEKNKLLYGKPRTTKSSGSSSRSGSAPARRRPTDDDEMDVDPSKLLTREEKRERRLQQQLNREFHSGKRTTFNGSYQKAGRRLPGGAVDLTTSNTPNAGANSSGKSVRERLAAMPNTLTKLNTVKRDTRTIDEIVRERAAAKQRTLLDGDEAKNSLTGLAQKGQIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.8
5 0.82
6 0.78
7 0.73
8 0.69
9 0.6
10 0.55
11 0.52
12 0.51
13 0.51
14 0.56
15 0.62
16 0.68
17 0.7
18 0.69
19 0.71
20 0.71
21 0.7
22 0.69
23 0.71
24 0.7
25 0.76
26 0.78
27 0.77
28 0.79
29 0.77
30 0.76
31 0.76
32 0.76
33 0.77
34 0.79
35 0.8
36 0.77
37 0.72
38 0.66
39 0.58
40 0.51
41 0.47
42 0.43
43 0.41
44 0.38
45 0.35
46 0.38
47 0.43
48 0.5
49 0.51
50 0.54
51 0.56
52 0.55
53 0.55
54 0.5
55 0.46
56 0.45
57 0.46
58 0.47
59 0.44
60 0.45
61 0.5
62 0.52
63 0.53
64 0.49
65 0.5
66 0.48
67 0.47
68 0.46
69 0.43
70 0.41
71 0.37
72 0.36
73 0.3
74 0.32
75 0.36
76 0.4
77 0.46
78 0.44
79 0.48
80 0.5
81 0.54
82 0.53
83 0.45
84 0.41
85 0.36
86 0.35
87 0.33
88 0.28
89 0.2
90 0.13
91 0.12
92 0.1
93 0.07
94 0.07
95 0.13
96 0.17
97 0.26
98 0.37
99 0.44
100 0.48
101 0.56
102 0.59
103 0.61
104 0.66
105 0.65
106 0.63
107 0.66
108 0.7
109 0.65
110 0.63
111 0.57
112 0.48
113 0.42
114 0.43
115 0.35
116 0.28
117 0.28
118 0.26
119 0.29
120 0.3
121 0.33
122 0.33
123 0.33
124 0.35
125 0.35
126 0.39
127 0.39
128 0.38
129 0.35
130 0.29
131 0.28
132 0.26
133 0.25
134 0.21
135 0.17
136 0.16
137 0.14
138 0.12
139 0.13
140 0.12
141 0.1
142 0.08
143 0.07
144 0.08
145 0.08
146 0.09
147 0.09
148 0.1
149 0.11
150 0.13
151 0.15
152 0.16
153 0.16
154 0.18
155 0.19
156 0.2
157 0.21
158 0.21
159 0.22
160 0.3
161 0.31
162 0.3
163 0.3
164 0.28
165 0.28
166 0.27
167 0.24
168 0.17
169 0.23
170 0.27
171 0.32
172 0.36
173 0.41
174 0.45
175 0.52
176 0.54
177 0.52
178 0.51
179 0.47
180 0.45
181 0.45
182 0.44
183 0.4
184 0.37
185 0.32
186 0.28
187 0.31
188 0.36
189 0.34
190 0.32
191 0.35
192 0.36
193 0.39
194 0.41
195 0.35
196 0.32
197 0.33
198 0.33
199 0.3
200 0.29
201 0.26
202 0.24
203 0.23
204 0.17
205 0.13
206 0.16
207 0.16
208 0.19
209 0.21