Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C7G0

Protein Details
Accession A1C7G0   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LWKIPWRISQPQKARQRKRLRAVDRVVHydrophilic
79-100FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG act:ACLA_073660  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLLSGLLWKIPWRISQPQKARQRKRLRAVDRVVDTLSAALRRNGQSTKAVDRWYAEMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.2
5 0.23
6 0.26
7 0.34
8 0.4
9 0.5
10 0.57
11 0.64
12 0.73
13 0.8
14 0.84
15 0.84
16 0.87
17 0.87
18 0.88
19 0.89
20 0.84
21 0.83
22 0.79
23 0.76
24 0.67
25 0.59
26 0.48
27 0.38
28 0.31
29 0.22
30 0.18
31 0.12
32 0.1
33 0.09
34 0.12
35 0.12
36 0.15
37 0.15
38 0.16
39 0.19
40 0.21
41 0.25
42 0.25
43 0.25
44 0.23
45 0.23
46 0.24
47 0.23
48 0.23
49 0.19
50 0.19
51 0.19
52 0.2
53 0.2
54 0.18
55 0.17
56 0.18
57 0.23
58 0.21
59 0.19
60 0.19
61 0.19
62 0.22
63 0.26
64 0.32
65 0.31
66 0.38
67 0.42
68 0.49
69 0.57
70 0.62
71 0.61
72 0.63
73 0.67
74 0.69
75 0.74
76 0.76
77 0.77
78 0.77
79 0.83
80 0.82
81 0.84
82 0.79
83 0.78
84 0.79
85 0.79
86 0.8
87 0.77
88 0.79