Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SLP9

Protein Details
Accession A0A2Z6SLP9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
133-166MPSTDNYKNPIKKKSRKSKKQKKQPEDTTPALKGHydrophilic
NLS Segment(s)
PositionSequence
142-172PIKKKSRKSKKQKKQPEDTTPALKGKERREK
Subcellular Location(s) nucl 16.5, mito_nucl 11.5, mito 5.5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSLKASLLETVTRRGVVDTLLALGNIGALPIDDQILRVDTILGKSAITQEVNFQELAKQTNLSYGVLMLMFRVSIATLQDTAAYLYFNASSQSFSNEEAAHKALKQKEPMKIDMPEKEIKYTNMDLSESSSSMPSTDNYKNPIKKKSRKSKKQKKQPEDTTPALKGKERREKDYPWRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.15
5 0.11
6 0.11
7 0.11
8 0.1
9 0.09
10 0.08
11 0.08
12 0.06
13 0.05
14 0.03
15 0.03
16 0.04
17 0.04
18 0.05
19 0.05
20 0.06
21 0.07
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.1
28 0.11
29 0.11
30 0.09
31 0.1
32 0.12
33 0.13
34 0.13
35 0.12
36 0.14
37 0.15
38 0.16
39 0.16
40 0.14
41 0.14
42 0.14
43 0.17
44 0.14
45 0.13
46 0.12
47 0.15
48 0.16
49 0.14
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.05
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.09
80 0.09
81 0.1
82 0.12
83 0.11
84 0.12
85 0.12
86 0.13
87 0.11
88 0.11
89 0.16
90 0.19
91 0.22
92 0.29
93 0.33
94 0.38
95 0.42
96 0.44
97 0.43
98 0.42
99 0.42
100 0.39
101 0.38
102 0.37
103 0.34
104 0.34
105 0.31
106 0.28
107 0.29
108 0.28
109 0.25
110 0.21
111 0.21
112 0.18
113 0.2
114 0.2
115 0.15
116 0.14
117 0.12
118 0.11
119 0.11
120 0.12
121 0.09
122 0.14
123 0.18
124 0.21
125 0.25
126 0.34
127 0.41
128 0.47
129 0.56
130 0.61
131 0.66
132 0.75
133 0.81
134 0.84
135 0.87
136 0.93
137 0.94
138 0.95
139 0.96
140 0.96
141 0.95
142 0.95
143 0.94
144 0.94
145 0.9
146 0.85
147 0.8
148 0.74
149 0.68
150 0.59
151 0.55
152 0.51
153 0.54
154 0.59
155 0.58
156 0.6
157 0.63
158 0.7