Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RII5

Protein Details
Accession A0A2Z6RII5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTTTSPRRIPRRRDSSRQAAFTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MTTTSPRRIPRRRDSSRQAAFTFLSNISLGTESYPPSNPRATAVPSHSVTSPSQPSDVSLKQANIEKQQQTINNDHEVLGNDKPSLQSNTKRTALSKPPKKTGGNPYSFQKFKNYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.85
4 0.81
5 0.71
6 0.63
7 0.54
8 0.45
9 0.39
10 0.28
11 0.22
12 0.16
13 0.15
14 0.12
15 0.12
16 0.11
17 0.09
18 0.1
19 0.09
20 0.11
21 0.14
22 0.15
23 0.17
24 0.19
25 0.17
26 0.18
27 0.2
28 0.21
29 0.22
30 0.24
31 0.26
32 0.25
33 0.26
34 0.24
35 0.24
36 0.22
37 0.22
38 0.21
39 0.16
40 0.16
41 0.14
42 0.16
43 0.18
44 0.18
45 0.16
46 0.16
47 0.15
48 0.17
49 0.2
50 0.21
51 0.21
52 0.26
53 0.25
54 0.25
55 0.28
56 0.3
57 0.3
58 0.33
59 0.31
60 0.28
61 0.27
62 0.25
63 0.23
64 0.21
65 0.2
66 0.17
67 0.15
68 0.12
69 0.13
70 0.13
71 0.15
72 0.19
73 0.21
74 0.28
75 0.33
76 0.4
77 0.43
78 0.43
79 0.43
80 0.46
81 0.51
82 0.55
83 0.59
84 0.6
85 0.64
86 0.7
87 0.72
88 0.72
89 0.73
90 0.72
91 0.69
92 0.65
93 0.65
94 0.66
95 0.64
96 0.57