Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R0E3

Protein Details
Accession A0A2Z6R0E3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-39TQEHSKDRSRMRGRSKERKKLSNNSHRYSHydrophilic
NLS Segment(s)
PositionSequence
4-30RSKERNKTQEHSKDRSRMRGRSKERKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MRGRSKERNKTQEHSKDRSRMRGRSKERKKLSNNSHRYSYLLECLKHYDENKQLSKILESGIERHVIASLSSSVKSSNKPVMIISSDNRSGEEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.75
4 0.74
5 0.77
6 0.75
7 0.73
8 0.75
9 0.77
10 0.79
11 0.81
12 0.86
13 0.86
14 0.85
15 0.86
16 0.84
17 0.84
18 0.85
19 0.85
20 0.83
21 0.76
22 0.73
23 0.63
24 0.57
25 0.49
26 0.4
27 0.35
28 0.3
29 0.26
30 0.22
31 0.24
32 0.24
33 0.24
34 0.23
35 0.22
36 0.24
37 0.3
38 0.31
39 0.3
40 0.3
41 0.28
42 0.28
43 0.24
44 0.18
45 0.15
46 0.14
47 0.15
48 0.14
49 0.15
50 0.14
51 0.13
52 0.13
53 0.1
54 0.1
55 0.09
56 0.1
57 0.1
58 0.11
59 0.11
60 0.13
61 0.15
62 0.18
63 0.21
64 0.26
65 0.26
66 0.26
67 0.27
68 0.29
69 0.3
70 0.31
71 0.29
72 0.29
73 0.3
74 0.3
75 0.3