Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QRX7

Protein Details
Accession A0A2Z6QRX7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
34-69SSSPSKTQKSLLKKKKNKKKKKSKNKNKQPVQGSSDHydrophilic
NLS Segment(s)
PositionSequence
42-61KSLLKKKKNKKKKKSKNKNK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MEIDQSLIDAFYTEDVTTEDNDSDIEIITFSQSSSSPSKTQKSLLKKKKNKKKKKSKNKNKQPVQGSSDTDEKVAAFFNKEGFLDKQLVAQYEALLLYIIEENLQHITAIDAME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.12
6 0.11
7 0.09
8 0.1
9 0.09
10 0.09
11 0.08
12 0.06
13 0.05
14 0.05
15 0.05
16 0.06
17 0.05
18 0.06
19 0.06
20 0.1
21 0.13
22 0.16
23 0.2
24 0.25
25 0.29
26 0.3
27 0.36
28 0.39
29 0.47
30 0.55
31 0.61
32 0.67
33 0.73
34 0.82
35 0.87
36 0.91
37 0.92
38 0.92
39 0.93
40 0.93
41 0.95
42 0.96
43 0.96
44 0.97
45 0.97
46 0.96
47 0.93
48 0.9
49 0.85
50 0.8
51 0.74
52 0.67
53 0.57
54 0.49
55 0.44
56 0.35
57 0.29
58 0.23
59 0.17
60 0.13
61 0.12
62 0.1
63 0.09
64 0.09
65 0.1
66 0.11
67 0.11
68 0.14
69 0.14
70 0.16
71 0.17
72 0.17
73 0.19
74 0.2
75 0.21
76 0.19
77 0.18
78 0.15
79 0.13
80 0.13
81 0.1
82 0.08
83 0.06
84 0.06
85 0.07
86 0.07
87 0.06
88 0.06
89 0.07
90 0.08
91 0.09
92 0.08
93 0.07
94 0.08