Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SG57

Protein Details
Accession A0A2Z6SG57    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33PYPLDVSKTNTKKKKKQKTIYKNLSQIKNHydrophilic
NLS Segment(s)
PositionSequence
16-20KKKKK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MHYFPYPLDVSKTNTKKKKKQKTIYKNLSQIKNDIITMNPTTITSKPVVIVASEVTERPLKPTNQCSIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.72
4 0.8
5 0.86
6 0.87
7 0.89
8 0.9
9 0.93
10 0.94
11 0.94
12 0.91
13 0.88
14 0.84
15 0.8
16 0.7
17 0.6
18 0.5
19 0.41
20 0.33
21 0.25
22 0.18
23 0.14
24 0.14
25 0.12
26 0.1
27 0.1
28 0.11
29 0.12
30 0.14
31 0.12
32 0.12
33 0.12
34 0.13
35 0.12
36 0.1
37 0.11
38 0.09
39 0.1
40 0.1
41 0.1
42 0.11
43 0.14
44 0.14
45 0.18
46 0.24
47 0.26
48 0.33
49 0.41