Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RWR6

Protein Details
Accession A0A2Z6RWR6    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-116SSPHDLPLKKNSRKKKLSKTSVASTHydrophilic
NLS Segment(s)
PositionSequence
100-107KKNSRKKK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MNCNAPLFSQTDYDFIMQRENERPRKKVLDELMDKYNTSMKRIYQIWRGEEANRIAWNQPIADISAGSERVLSDGSAIMPSAKIGGAPGITSSPHDLPLKKNSRKKKLSKTSVASTETDDTINHTPSNDNISRMGSELEKVLKEMDDIGNSIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.22
4 0.2
5 0.23
6 0.3
7 0.37
8 0.46
9 0.51
10 0.53
11 0.55
12 0.62
13 0.6
14 0.6
15 0.58
16 0.58
17 0.57
18 0.58
19 0.56
20 0.5
21 0.47
22 0.4
23 0.38
24 0.29
25 0.26
26 0.24
27 0.2
28 0.24
29 0.28
30 0.32
31 0.34
32 0.38
33 0.38
34 0.39
35 0.4
36 0.35
37 0.37
38 0.34
39 0.29
40 0.25
41 0.23
42 0.2
43 0.19
44 0.19
45 0.14
46 0.12
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.09
80 0.09
81 0.12
82 0.14
83 0.16
84 0.19
85 0.29
86 0.39
87 0.44
88 0.52
89 0.59
90 0.68
91 0.76
92 0.82
93 0.83
94 0.84
95 0.86
96 0.87
97 0.83
98 0.8
99 0.76
100 0.69
101 0.59
102 0.51
103 0.44
104 0.35
105 0.29
106 0.21
107 0.2
108 0.2
109 0.2
110 0.17
111 0.16
112 0.16
113 0.17
114 0.25
115 0.23
116 0.21
117 0.21
118 0.23
119 0.23
120 0.23
121 0.23
122 0.16
123 0.15
124 0.16
125 0.18
126 0.17
127 0.17
128 0.17
129 0.15
130 0.15
131 0.18
132 0.17
133 0.16